PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_01832.1_g00005.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family NAC
Protein Properties Length: 348aa    MW: 39289.9 Da    PI: 7.6329
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_01832.1_g00005.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM164.34.5e-51141421129
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleev.ikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWka 85 
                              lppGfrFhP+deel+++yL kkv+++  + +   + evd++k+ePw++p+ +  + kewyf+s+rd+kyatg r+nrat sgyWka
  Sme2.5_01832.1_g00005.1  14 LPPGFRFHPRDEELICDYLMKKVDQSVDQQQYPlLIEVDLNKSEPWEIPEIACVGGKEWYFYSQRDRKYATGLRTNRATVSGYWKA 99 
                              79**********************999666555599*************7666689****************************** PP

                      NAM  86 tgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                              tgkd+++++ kg+lvg++ktLvfy+grapkg+k+dWvmhe+rle
  Sme2.5_01832.1_g00005.1 100 TGKDRAIIR-KGSLVGMRKTLVFYQGRAPKGRKSDWVMHEFRLE 142
                              ********9.999****************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.45E-593168IPR003441NAC domain
PROSITE profilePS5100556.77614167IPR003441NAC domain
PfamPF023654.0E-2615141IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 348 aa     Download sequence    Send to blast
MSSNSSLSMV ESKLPPGFRF HPRDEELICD YLMKKVDQSV DQQQYPLLIE VDLNKSEPWE  60
IPEIACVGGK EWYFYSQRDR KYATGLRTNR ATVSGYWKAT GKDRAIIRKG SLVGMRKTLV  120
FYQGRAPKGR KSDWVMHEFR LEGPLSNTRS QISSTKEDWV LCRVFHKNKE LLAAQHGTGS  180
NNIYYDNDTI SSSTLPTLMD PYINFDQTNP TNNINMNELY YEQVPCFSIF TPNQTFTSHN  240
HHHHHPPTAT GSTPVTATYG GFPADIGNYL NATTTSSTCD NKVIKAVLSH LSTKNIVEGN  300
NNNNNDIINR AQNIVNIKGG NSPSFGEGSS ETSFLSEVVY PTTMWNNY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A4e-5011684166NO APICAL MERISTEM PROTEIN
1ut4_B4e-5011684166NO APICAL MERISTEM PROTEIN
1ut7_A4e-5011684166NO APICAL MERISTEM PROTEIN
1ut7_B4e-5011684166NO APICAL MERISTEM PROTEIN
3swm_A5e-5011687169NAC domain-containing protein 19
3swm_B5e-5011687169NAC domain-containing protein 19
3swm_C5e-5011687169NAC domain-containing protein 19
3swm_D5e-5011687169NAC domain-containing protein 19
3swp_A5e-5011687169NAC domain-containing protein 19
3swp_B5e-5011687169NAC domain-containing protein 19
3swp_C5e-5011687169NAC domain-containing protein 19
3swp_D5e-5011687169NAC domain-containing protein 19
4dul_A4e-5011684166NAC domain-containing protein 19
4dul_B4e-5011684166NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY3088281e-165AY308828.1 Capsicum annuum salicylic acid-induced protein 19 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006346053.10.0PREDICTED: NAC domain-containing protein 21/22-like
SwissprotQ84TE61e-111NAC22_ARATH; NAC domain-containing protein 21/22
TrEMBLM1C0290.0M1C029_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000569160.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA13424297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G56010.21e-108NAC domain containing protein 1